PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00000739-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 95aa    MW: 11090.9 Da    PI: 10.3208
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00000739-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.5e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+W++ Ed +l+++vk +G g W+ ++++ g++R++k+c++rw++yl
  WALNUT_00000739-RA 14 RGAWSAREDNILINYVKAHGEGKWRDVPERAGLKRCGKSCRLRWLNYL 61
                        89*********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129424.304965IPR017930Myb domain
SMARTSM007176.8E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
SuperFamilySSF466897.35E-231588IPR009057Homeodomain-like
CDDcd001677.86E-101661No hitNo description
Gene3DG3DSA:1.10.10.607.2E-86588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MGRRPCCTKE GLNRGAWSAR EDNILINYVK AHGEGKWRDV PERAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SVEEEELIIR LHKLLGNRPV SEIFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-14128825100MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015889356.13e-52PREDICTED: myb-related protein 308 isoform X1
SwissprotP102907e-47MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A059CLX47e-52A0A059CLX4_EUCGR; Uncharacterized protein
TrEMBLA0A067KCF45e-52A0A067KCF4_JATCU; Uncharacterized protein
STRINGPOPTR_0006s23840.19e-51(Populus trichocarpa)
STRINGGSMUA_Achr3P07940_0018e-51(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07690.13e-44myb domain protein 29